PDB entry 1rzx

View 1rzx on RCSB PDB site
Description: Crystal Structure of a Par-6 PDZ-peptide Complex
Class: cell cycle
Keywords: cell cycle
Deposited on 2003-12-29, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg5884-pa
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Par-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rzxa_
  • Chain 'B':
    Compound: Acetylated VKESLV Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZX (Start-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rzxA (A:)
ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn
devievngievagktldqvtdmmvanssnliitvkpan

  • Chain 'B':
    No sequence available.