PDB entry 1rzl

View 1rzl on RCSB PDB site
Description: rice nonspecific lipid transfer protein
Class: lipid transport
Keywords: lipid transport, alpha-helical structure
Deposited on 1997-10-09, released 1998-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.186
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nonspecific lipid transfer protein
  Species: Oryza sativa [TaxId:4530]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23096 (0-90)
  Domains in SCOPe 2.06: d1rzla_
• Heterogens: SO4, CXS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rzlA (A:)
  itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
  lnagnaasipskcgvsvpytisasidcsrvs