PDB entry 1ryz

View 1ryz on RCSB PDB site
Description: Uridine Phosphorylase from Salmonella typhimurium. Crystal Structure at 2.9 A Resolution
Class: transferase
Keywords: uridine phosphorylase, nucleoside phosphorylase, TRANSFERASE
Deposited on 2003-12-23, released 2004-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.212
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ryza_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ryzb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ryzc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ryzd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ryze_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ryzf_
  • Heterogens: ACY

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ryzA (A:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryzA (A:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ryzB (B:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryzB (B:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ryzC (C:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryzC (C:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ryzD (D:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryzD (D:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ryzE (E:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryzE (E:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ryzF (F:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryzF (F:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll