![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein Uridine phosphorylase [53176] (6 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries) Uniprot P0A1F6 |
![]() | Domain d1ryzb_: 1ryz B: [111976] complexed with acy |
PDB Entry: 1ryz (more details), 2.9 Å
SCOPe Domain Sequences for d1ryzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryzb_ c.56.2.1 (B:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]} sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk ivveaarrll
Timeline for d1ryzb_: