PDB entry 1rw5

View 1rw5 on RCSB PDB site
Description: Solution structure of human prolactin
Class: hormone/growth factor
Keywords: Four helix bundle, cytokine, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-12-16, released 2005-02-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rw5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rw5A (A:)
    lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
    sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
    eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
    kidnylkllkcriihnnnc