PDB entry 1ron

View 1ron on RCSB PDB site
Description: nmr solution structure of human neuropeptide y
Class: neuropeptide
Keywords: neuropeptide, cleavage on pair of basic residues, signal, amidation, neuromodulator
Deposited on 1996-01-11, released 1996-08-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neuropeptide y
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01303 (0-35)
  Domains in SCOPe 2.02: d1rona_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ronA (A:)
  ypskpdnpgedapaedmaryysalrhyinlitrqry