PDB entry 1rn7

View 1rn7 on RCSB PDB site
Description: Structure of human cystatin D
Class: protein binding
Keywords: inhibitor of cysteine peptidases, cystatin D, PROTEIN BINDING
Deposited on 2003-11-30, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystatin D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28325 (Start-121)
      • engineered (25)
    Domains in SCOPe 2.08: d1rn7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rn7A (A:)
gsasaqsrtlaggihatdlndksvqraldfaiseynkvinkdeyysrplqvmaayqqivg
gvnyyfnvkfgrttctksqpnldncpfndqpklkeeefcsfqinevpwedkisilnykcr
kv

    Sequence, based on observed residues (ATOM records): (download) 
    >1rn7A (A:)
aggihatdlndksvqraldfaiseynkvinkdeyysrplqvmaayqqivggvnyyfnvkf
grttctksqpnldncpfndqpklkeeefcsfqinevpwedkisilnykcrkv