SCOPe 2.08: Domain d1rn7a_: 1rn7 A:

Lineage for d1rn7a_ (1rn7 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin D [110819] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110820] (2 PDB entries)
   Uniprot P28325 31-142

8. Domain d1rn7a_: 1rn7 A: [105019]

Details for d1rn7a_

PDB Entry: 1rn7, 2.5 Å

PDB Description: structure of human cystatin d

PDB Compounds: (A:) Cystatin D

SCOPe Domain Sequences for d1rn7a_:

Sequence; same for both SEQRES and ATOM records:

>d1rn7a_ d.17.1.2 (A:) Cystatin D {Human (Homo sapiens) [TaxId: 9606]}
aggihatdlndksvqraldfaiseynkvinkdeyysrplqvmaayqqivggvnyyfnvkf
grttctksqpnldncpfndqpklkeeefcsfqinevpwedkisilnykcrkv

Timeline for d1rn7a_:

• d1rn7a_ first appeared in SCOP 1.69
  
• d1rn7a_ appears in SCOPe 2.07