PDB entry 1rm8

View 1rm8 on RCSB PDB site
Description: Crystal structure of the catalytic domain of MMP-16/MT3-MMP: Characterization of MT-MMP specific features
Class: hydrolase
Keywords: MMP-16, MT3-MMP, MT-MMP, Membrane Type - Matrix Metalloproteinase, Batimastat, Hydroxamate inhibitor, Protease, HYDROLASE
Deposited on 2003-11-27, released 2004-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Matrix metalloproteinase-16
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51512 (0-168)
  Domains in SCOPe 2.07: d1rm8a_
• Heterogens: ZN, CA, BAT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rm8A (A:)
  gqkwqhkhitysiknvtpkvgdpetrkairrafdvwqnvtpltfeevpyselengkrdvd
  itiifasgfhgdsspfdgeggflahayfpgpgiggdthfdsdepwtlgnpnhdgndlflv
  avhelghalglehsndptaimapfyqymetdnfklpnddlqgiqkiygp