PDB entry 1rls

View 1rls on RCSB PDB site
Description: crystal structure of RNAse t1 complexed with the product nucleotide 3'-gmp. structural evidence for direct interaction of histidine 40 and glutamic acid 58 with the 2'-hydroxyl group of ribose
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1994-03-29, released 1994-12-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease t1
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rlsa_
  • Heterogens: CA, 3GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rlsA (A:)
    acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect