PDB entry 1rjv

View 1rjv on RCSB PDB site
Description: Solution Structure of Human alpha-Parvalbumin refined with a paramagnetism-based strategy
Class: metal binding protein
Keywords: calcium, parvalbumin, EF-hand, NMR, lanthanide, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL BINDING PROTEIN
Deposited on 2003-11-20, released 2004-05-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PVALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1rjva_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjvA (A:)
    msmtdllnaedikkavgafsatdsfdhkkffqmvglkkksaddvkkvfhmldkdksgfie
    edelgfilkgfspdardlsaketkmlmaagdkdgdgkigvdefstlvaes