PDB entry 1rjh

View 1rjh on RCSB PDB site
Description: Structure of the Calcium Free Form of the C-type Lectin-like Domain of Tetranectin
Class: protein binding
Keywords: Apo, Calcium Free, CTLD, C-type Lectin-like Domain, Plasminogen kringle 4 binding, Tetranectin, Trans Proline, PROTEIN BINDING
Deposited on 2003-11-19, released 2004-07-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetranectin
    Species: Homo sapiens [TaxId:9606]
    Gene: TNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rjha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjhA (A:)
    ftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlglndmaaegtw
    vdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlpyicqfgiv