PDB entry 1rgw

View 1rgw on RCSB PDB site
Description: Solution Structure of ZASP's PDZ domain
Class: structural protein
Keywords: zasp, pdz, cypher, oracle, muscle, z-disk, sarcomere, structural protein
Deposited on 2003-11-13, released 2004-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ZASP protein
  Species: Homo sapiens [TaxId:9606]
  Gene: ZASP
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75112 (0-84)
    • engineered (1)
  Domains in SCOPe 2.04: d1rgwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rgwA (A:)
  maysvtltgpgpwgfrlqggkdfnmpltisritpgskaaqsqlsqgdlvvaidgvntdtm
  thleaqnkiksasynlsltlqkskr