PDB entry 1rgv

View 1rgv on RCSB PDB site
Description: Crystal Structure of the Ferredoxin from Thauera aromatica
Class: electron transport
Keywords: electron transport
Deposited on 2003-11-13, released 2004-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.197
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Thauera aromatica [TaxId:44139]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O88151 (0-79)
  Domains in SCOPe 2.08: d1rgva_
• Heterogens: SF4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rgvA (A:)
  alyinddctacdacveecpneaitpgdpiyvidptkcsecvgafdepqcrlvcpadcipd
  npdyretreelqekydrlhg