Lineage for d1rgva_ (1rgv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949056Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
    contains two 4Fe-4S clusters
  6. 2949057Protein Ferredoxin II [54864] (5 species)
  7. 2949068Species Thauera aromatica [TaxId:59405] [102954] (1 PDB entry)
  8. 2949069Domain d1rgva_: 1rgv A: [97454]
    complexed with sf4

Details for d1rgva_

PDB Entry: 1rgv (more details), 2.9 Å

PDB Description: Crystal Structure of the Ferredoxin from Thauera aromatica
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1rgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}
alyinddctacdacveecpneaitpgdpiyvidptkcsecvgafdepqcrlvcpadcipd
npdyretreelqekydrlhg

SCOPe Domain Coordinates for d1rgva_:

Click to download the PDB-style file with coordinates for d1rgva_.
(The format of our PDB-style files is described here.)

Timeline for d1rgva_: