PDB entry 1rgk

View 1rgk on RCSB PDB site
Description: rnase t1 mutant glu46gln binds the inhibitors 2'gmp and 2'amp at the 3' subsite
Deposited on 1992-02-19, released 1993-01-15
The last revision prior to the SCOP 1.61 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.87 Å
R-factor: 0.142
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1rgk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rgk_ (-)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyqgfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect