PDB entry 1rf2

View 1rf2 on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV4
Class: toxin
Keywords: Bivalent, Cholera, Toxin, Pentamer, Complex
Deposited on 2003-11-07, released 2004-10-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.134
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rf2d_
• Chain 'E':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rf2e_
• Chain 'F':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rf2f_
• Chain 'G':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rf2g_
• Chain 'H':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rf2h_
• Heterogens: BV4, TRS, PGE, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rf2D (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rf2E (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rf2F (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rf2G (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rf2H (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman