PDB entry 1rdn

View 1rdn on RCSB PDB site
Description: mannose-binding protein, subtilisin digest fragment complex with alpha-methyl-d-n-acetylglucosaminide
Deposited on 1995-09-05, released 1996-03-08
The last revision prior to the SCOP 1.63 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.63: d1rdn1_
  • Chain '2':
    Domains in SCOP 1.63: d1rdn2_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdn1 (1:)
    kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
    dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdn2 (2:)
    kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
    edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs