PDB entry 1rcv

View 1rcv on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV1
Class: toxin
Keywords: Bivalent, Cholera, Toxin, Pentamer, Complex
Deposited on 2003-11-04, released 2004-10-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.166
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rcvd_
• Chain 'E':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rcve_
• Chain 'F':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rcvf_
• Chain 'G':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rcvg_
• Chain 'H':
  Compound: cholera toxin B protein (CTB)
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
  Domains in SCOPe 2.04: d1rcvh_
• Heterogens: BV1, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rcvD (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rcvE (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rcvF (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rcvG (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rcvH (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman