PDB entry 1rc9

View 1rc9 on RCSB PDB site
Description: Crystal Structure of Stecrisp, a Member of CRISP Family from Trimeresurus Stejnegeri Refined at 1.6 Angstroms Resolution: Structual relationship of the two domains
Class: toxin
Keywords: beta-alpha sandwich, double domains, short helixs motif, toxin
Deposited on 2003-11-03, released 2005-01-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cysteine-rich secretory protein
  Species: Viridovipera stejnegeri [TaxId:39682]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60623 (0-220)
  Domains in SCOPe 2.04: d1rc9a1, d1rc9a2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rc9A (A:)
  nvdfdsesprkpeiqneivdlhnslrrsvnptasnmlrmewypeaadnaerwayrciesh
  ssyesrviegikcgeniymspypmkwtdiihawhdeykdfkygvgadppnavtghytqiv
  wyksyrigcaaaycpsspysyffvcqycpagnfigktatpytsgtpcgdcpsdcdnglct
  npctrenkftncntmvqqsscqdnymktncpascfcqnkii