PDB entry 1r8p

View 1r8p on RCSB PDB site
Description: HPV-16 E2C solution structure
Class: transcription
Keywords: dimeric beta-barrel, DNA binding protein, transcription factor
Deposited on 2003-10-28, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 16 [TaxId:333760]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03120 (1-80)
      • initiating met (0)
    Domains in SCOPe 2.07: d1r8pa_
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 16 [TaxId:333760]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03120 (1-80)
      • initiating met (0)
    Domains in SCOPe 2.07: d1r8pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r8pA (A:)
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r8pB (B:)
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi