PDB entry 1r8o

View 1r8o on RCSB PDB site
Description: Crystal structure of an unusual Kunitz-type trypsin inhibitor from Copaifera langsdorffii seeds
Class: hydrolase inhibitor
Keywords: Kunitz (STI) trypsin inhibitor, beta-trefoil fold, Copaifera langsdorffii, HYDROLASE INHIBITOR
Deposited on 2003-10-27, released 2004-05-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.17
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz trypsin inhibitor
    Species: Copaifera langsdorffii [TaxId:280048]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r8o.1
  • Chain 'B':
    Compound: Kunitz trypsin inhibitor
    Species: Copaifera langsdorffii [TaxId:280048]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1r8o.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8oA (A:)
    rlvdtdgkpiendgaeyyilpsvrgkggglvlaksggekcplsvvqspselsnglpvrfk
    asprskyisvgmllgieviespecapkpsmwsvksg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r8oB (B:)
    wklpsvtvgnpkvsvfggpfkieegksgykdvyssskgrdlddgievnkkkekrlvvkdg
    npfiirfkksg