PDB entry 1r83

View 1r83 on RCSB PDB site
Description: Solution structure of Sso7d mutant (K12L), NMR, 4 structures
Class: hydrolase
Keywords: RNAse and DNA-binding protein, thermostable ribonuclease, nmr, sulfolobus solfataricus, single point mutation
Deposited on 2003-10-23, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-01.
Experiment type: NMR4
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein 7a
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61991 (0-61)
      • engineered (11)
    Domains in SCOP 1.73: d1r83a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r83A (A:)
    atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qk