![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (3 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein) |
![]() | Protein DNA-binding protein [54162] (2 species) |
![]() | Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries) |
![]() | Domain d1r83a_: 1r83 A: [111717] Sso7a variant mutant |
PDB Entry: 1r83 (more details)
SCOP Domain Sequences for d1r83a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r83a_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d [TaxId: 2287]} atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek qk
Timeline for d1r83a_: