PDB entry 1r5e

View 1r5e on RCSB PDB site
Description: Solution structure of the folded core of Pseudomonas syringae effector protein, AvrPto
Class: protein binding
Keywords: three-helix bundle, omega loop, PROTEIN BINDING
Deposited on 2003-10-10, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avirulence protein
    Species: Pseudomonas syringae [TaxId:317]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r5ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r5eA (A:)
mdnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqh
rymtgasginpgmlphenvddmrsaitdwsdmrealqhamgihadivdykddddk

    Sequence, based on observed residues (ATOM records): (download) 
    >1r5eA (A:)
dnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqhr
ymtgasginpgmlphenvddmrsaitdwsdmrealqhamgihadi