Lineage for d1r5ea_ (1r5e A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697301Superfamily a.8.8: Avirulence protein AvrPto [116854] (1 family) (S)
    automatically mapped to Pfam PF11592
  5. 2697302Family a.8.8.1: Avirulence protein AvrPto [116855] (1 protein)
  6. 2697303Protein Avirulence protein AvrPto [116856] (1 species)
  7. 2697304Species Pseudomonas syringae [TaxId:317] [116857] (2 PDB entries)
    Uniprot Q08242 29-133
  8. 2697306Domain d1r5ea_: 1r5e A: [111701]

Details for d1r5ea_

PDB Entry: 1r5e (more details)

PDB Description: solution structure of the folded core of pseudomonas syringae effector protein, avrpto
PDB Compounds: (A:) Avirulence protein

SCOPe Domain Sequences for d1r5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ea_ a.8.8.1 (A:) Avirulence protein AvrPto {Pseudomonas syringae [TaxId: 317]}
dnvtssqllsvrhqlaesaglprdqhefvssqapqslrnrynnlyshtqrtldmadmqhr
ymtgasginpgmlphenvddmrsaitdwsdmrealqhamgihadi

SCOPe Domain Coordinates for d1r5ea_:

Click to download the PDB-style file with coordinates for d1r5ea_.
(The format of our PDB-style files is described here.)

Timeline for d1r5ea_: