PDB entry 1qzc

View 1qzc on RCSB PDB site
Description: Coordinates of S12, SH44, LH69 and SRL separately fitted into the cryo-EM map of EF-Tu ternary complex (GDP.Kirromycin) bound 70S ribosome
Class: RNA Binding Protein/RNA
Keywords: ribosomal protein, rRNA, RNA Binding Protein/RNA COMPLEX
Deposited on 2003-09-16, released 2003-11-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: 23s rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'C':
    Compound: 23s rRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qzcl_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1qzcL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzcL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea