PDB entry 1qwv

View 1qwv on RCSB PDB site
Description: Solution structure of Antheraea polyphemus pheromone binding protein (ApolPBP)
Class: transport protein
Keywords: pheromone binding protein, Antheraea polyphemus, PBP, ApolPBP, hexahelical fold, PBP fold, TRANSPORT PROTEIN
Deposited on 2003-09-03, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Antheraea polyphemus [TaxId:7120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qwva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qwvA (A:)
    speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
    vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
    eihklnwvpnmdlvigevlaev