Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein Moth pheromone-binding protein, PBP [47569] (2 species) |
Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries) |
Domain d1qwva_: 1qwv A: [96506] |
PDB Entry: 1qwv (more details)
SCOPe Domain Sequences for d1qwva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwva_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]} speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk eihklnwvpnmdlvigevlaev
Timeline for d1qwva_: