PDB entry 1qvp

View 1qvp on RCSB PDB site
Description: c terminal sh3-like domain from diphtheria toxin repressor residues 144-226.
Deposited on 2003-08-28, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: NMR13
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1qvpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qvpA (A:)
  gshmdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrd
  ghitlshngkdvellddlahtirieel