![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins) |
![]() | Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [50043] (14 PDB entries) |
![]() | Domain d1qvpa_: 1qvp A: [111659] C-terminal domain only |
PDB Entry: 1qvp (more details)
SCOP Domain Sequences for d1qvpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvpa_ b.34.1.2 (A:) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae} gshmdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrd ghitlshngkdvellddlahtirieel
Timeline for d1qvpa_: