Lineage for d1qvpa_ (1qvp A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557281Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 557289Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins)
  6. 557290Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 557291Species Corynebacterium diphtheriae [TaxId:1717] [50043] (14 PDB entries)
  8. 557307Domain d1qvpa_: 1qvp A: [111659]
    C-terminal domain only

Details for d1qvpa_

PDB Entry: 1qvp (more details)

PDB Description: C terminal SH3-like domain from Diphtheria toxin Repressor residues 144-226.

SCOP Domain Sequences for d1qvpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvpa_ b.34.1.2 (A:) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
gshmdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrd
ghitlshngkdvellddlahtirieel

SCOP Domain Coordinates for d1qvpa_:

Click to download the PDB-style file with coordinates for d1qvpa_.
(The format of our PDB-style files is described here.)

Timeline for d1qvpa_: