PDB entry 1qri

View 1qri on RCSB PDB site
Description: x-ray structure of the DNA-eco ri endonuclease complexes with an e144d mutation at 2.7 a
Class: hydrolase/DNA
Keywords: restriction endonuclease, DNA-protein complex, site-directed mutation, sequence-specific, protein structure, hydrolase-DNA complex
Deposited on 1999-06-14, released 1999-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eco ri endonculease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00642 (0-260)
      • engineered (127)
    Domains in SCOPe 2.07: d1qria_
  • Chain 'M':
    Compound: 5'-d(*tp*cp*gp*cp*gp*ap*ap*tp*tp*cp*gp*cp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qriA (A:)
    sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
    lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
    maagnaidrshkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
    ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
    disttslrvlgrdlfeqltsk
    

  • Chain 'M':
    No sequence available.