PDB entry 1qo6

View 1qo6 on RCSB PDB site
Description: solution structure of a pair of modules from the gelatin-binding domain of fibronectin
Class: cell adhesion protein
Keywords: cell adhesion protein, fibronectin module pair, gelatin-binding
Deposited on 1999-11-04, released 2000-01-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1qo6a1, d1qo6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qo6A (A:)
    yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqetavtqtyggnsngepcvlpf
    tyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdht