PDB entry 1qm7

View 1qm7 on RCSB PDB site
Description: x-ray structure of a three-fingered chimeric protein, stability of a structural scaffold
Class: toxin
Keywords: toxin, stability of a structural scaffold
Deposited on 1999-09-21, released 2000-03-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: -1.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: r-chii
    Species: synthetic, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QM7 (0-60)
    Domains in SCOPe 2.04: d1qm7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qm7A (A:)
    tmcyshtttsrailtncpgetncykksrrhppkmvlgrgcgcptvapgiklnccttdkcn
    y