PDB entry 1qhq

View 1qhq on RCSB PDB site
Description: auracyanin, a blue copper protein from the green thermophilic photosynthetic bacterium chloroflexus aurantiacus
Class: electron transfer
Keywords: electron transfer, cupredoxin, blue copper protein, azurin-like, thermophile
Deposited on 1999-05-25, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.198
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (auracyanin)
    Species: Chloroflexus aurantiacus [TaxId:1108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qhqa_
  • Heterogens: CU, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1qhqA (A:)
aanapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwv
lvnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtyly
ictfpghylagmkgtltvtp

    Sequence, based on observed residues (ATOM records): (download) 
    >1qhqA (A:)
anapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwvl
vnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtylyi
ctfpghylagmkgtltvtp