PDB entry 1qhk

View 1qhk on RCSB PDB site
Description: n-terminal domain of saccharomyces cerevisiae RNAse hi reveals a fold with a resemblance to the n-terminal domain of ribosomal protein l9
Class: hydrolase
Keywords: ribonuclease hi n-terminal domain, hydrolase
Deposited on 1999-05-17, released 1999-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ribonuclease hi)
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04740 (0-46)
  Domains in SCOPe 2.07: d1qhka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qhkA (A:)
  gnfyavrkgretgiyntwnecknqvdgyggaiykkfnsyeqaksflg