PDB entry 1qhd

View 1qhd on RCSB PDB site
Description: crystal structure of vp6, the major capsid protein of group a rotavirus
Class: Viral protein
Keywords: VIRAL CAPSID PROTEIN, Viral protein
Deposited on 1999-04-29, released 2001-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral capsid vp6
    Species: Bovine rotavirus [TaxId:129818]
    Gene: SEGMENT 6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04509 (0-396)
      • see remark 999 (141)
    Domains in SCOPe 2.06: d1qhda1, d1qhda2
  • Heterogens: ZN, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qhdA (A:)
    mdvlyslsktlkdardkivegtlysnvsdliqqfnqmiitmngnefqtggignlpirnwn
    fdfgllgttllnldanyvetarntidyfvdfvdnvcmdemvresqrngiapqsdslikls
    gikfkrinfdnsseyienwnlqnrrqrtgftfhkpnifpysasftlnrsqpahdnlmgtm
    wlnagseiqvagfdyscainapantqqfehivqlrrvlttatitllpdaerfsfprvits
    adgattwyfnpvilrpnnveiefllngqiintyqarfgtiiarnfdtirlsfqlmrppnm
    tpavaalfpnaqpfehhatvgltlriesavcesvladasetmlanvtsvrqeyaipvgpv
    fppgmnwtdlitnyspsrednlqrvftvasirsmlvk