PDB entry 1qgb

View 1qgb on RCSB PDB site
Description: solution structure of the n-terminal f1 module pair from human fibronectin
Deposited on 1999-04-21, released 1999-12-08
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-08, with a file datestamp of 1999-12-07.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qgbA (A:)
skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskpeaeetcfdkytgntyr
vgdtyerpkdsmiwdctcigagrgrisctianr