PDB entry 1qbf

View 1qbf on RCSB PDB site
Description: nmr solution structure of porcine peptide yy
Class: inhibitor/hormone
Keywords: pp-fold, pancreatic hormone, , inhibitor/hormone complex
Deposited on 1999-04-16, released 2000-08-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptide YY
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68005 (0-35)
  Domains in SCOPe 2.04: d1qbfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qbfA (A:)
  ypakpeapgedaspeelsryyaslrhylnlvtrqry