PDB entry 1qb5

View 1qb5 on RCSB PDB site
Description: escherichia coli heat labile enterotoxin type iib b-pentamer
Class: enterotoxin
Keywords: enterotoxin
Deposited on 1999-04-30, released 2003-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: protein (heat labile enterotoxin type iib b-pentamer)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qb5d_
  • Chain 'E':
    Compound: protein (heat labile enterotoxin type iib b-pentamer)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qb5e_
  • Chain 'F':
    Compound: protein (heat labile enterotoxin type iib b-pentamer)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qb5f_
  • Chain 'G':
    Compound: protein (heat labile enterotoxin type iib b-pentamer)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qb5g_
  • Chain 'H':
    Compound: protein (heat labile enterotoxin type iib b-pentamer)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qb5h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qb5D (D:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qb5E (E:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qb5F (F:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qb5G (G:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qb5H (H:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae