PDB entry 1qam
View 1qam on RCSB PDB site
Description: the structure of the rRNA methyltransferase ermc': implications for the reaction mechanism
Class: transferase
Keywords: rRNA methyltransferase ermc', cofactor analogs
Deposited on
1999-03-25, released
2000-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ermc' methyltransferase
Species: Bacillus subtilis [TaxId:1423]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1qama_ - Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1qamA (A:)
mneknikhsqnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaiei
dhklckttenklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsia
deiyliveygfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkk
srishkdkqkynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyk
lfnk
Sequence, based on observed residues (ATOM records): (download)
>1qamA (A:)
qnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktte
nklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylivey
gfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdkq
kynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk