PDB entry 1q8k

View 1q8k on RCSB PDB site
Description: Solution structure of alpha subunit of human eIF2
Class: translation
Keywords: Translation, Translation Initiation, Eukaryotic translation initiation factor 2
Deposited on 2003-08-21, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 2 subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2S1 OR EIF2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05198 (1-299)
      • cloning artifact (0)
      • engineered (24)
      • engineered (43)
      • engineered (68)
    Domains in SCOPe 2.07: d1q8ka2, d1q8ka3, d1q8ka4, d1q8ka5

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8kA (A:)
    mscrfyqhkfpevedvvmvnvrsiqemgayvslleynniegmihlselsrrrirsinkli
    rigrnecvkvirvdkekgyidlskrrvspeeaikcedkftksktvysilrhvaevleytk
    deqleslfqrtawvfddkykrpgygaydafkhavsdpsildsldlnederevlinninrr
    ltpqavkiradievacygyegidavkealraglncstenmpikinliappryvmttttle
    rteglsvlsqamavikekieekrgvfnvqmepkvvtdtdetelarqmerlerenaevdgd
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8kA (A:)
    mscrfyqhkfpevedvvmvnvrsiqemgayvslleynniegmihlselsrrrirsinkli
    rigrnecvkvirvdkekgyidlskrrvspeeaikcedkftksktvysilrhvaevleytk
    deqleslfqrtawvfddkykrpgygaydafkhavsdpsildsldlnederevlinninrr
    ltpqavkiradievacygyegidavkealraglncstenmpikinliappryvmttttle
    rteglsvlsqamavikekieekrgvfnvqmepkvvtdtdetelarqmerlerenaevdgd