Lineage for d1q8ka2 (1q8k A:186-302)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955778Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) (S)
  5. 2955779Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)
  6. 2955780Protein eIF-2-alpha, C-terminal domain [110995] (2 species)
  7. 2955781Species Human (Homo sapiens) [TaxId:9606] [110996] (1 PDB entry)
    Uniprot P05198
  8. 2955782Domain d1q8ka2: 1q8k A:186-302 [104557]
    Other proteins in same PDB: d1q8ka3, d1q8ka4, d1q8ka5

Details for d1q8ka2

PDB Entry: 1q8k (more details)

PDB Description: solution structure of alpha subunit of human eif2
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 subunit 1

SCOPe Domain Sequences for d1q8ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ka2 d.58.51.1 (A:186-302) eIF-2-alpha, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qavkiradievacygyegidavkealraglncstenmpikinliappryvmttttlerte
glsvlsqamavikekieekrgvfnvqmepkvvtdtdetelarqmerlerenaevdgd

SCOPe Domain Coordinates for d1q8ka2:

Click to download the PDB-style file with coordinates for d1q8ka2.
(The format of our PDB-style files is described here.)

Timeline for d1q8ka2: