PDB entry 1q8g

View 1q8g on RCSB PDB site
Description: NMR structure of human Cofilin
Class: structural protein
Keywords: cofilin/ADF, actin cytoskeleton, NMR spectroscopy, G-actin binding, STRUCTURAL PROTEIN
Deposited on 2003-08-21, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cofilin, non-muscle isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: CFL1 OR CFL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q8ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q8gA (A:)
    masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv
    gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass
    kdaikkkltgikhelqancyeevkdrctlaeklggsavislegkpl