Lineage for d1q8ga_ (1q8g A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534346Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2534359Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species)
  7. 2534368Species Human (Homo sapiens), non-muscle isoform [TaxId:9606] [111104] (3 PDB entries)
    Uniprot P23528
  8. 2534371Domain d1q8ga_: 1q8g A: [104555]

Details for d1q8ga_

PDB Entry: 1q8g (more details)

PDB Description: NMR structure of human Cofilin
PDB Compounds: (A:) Cofilin, non-muscle isoform

SCOPe Domain Sequences for d1q8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ga_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Human (Homo sapiens), non-muscle isoform [TaxId: 9606]}
masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv
gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass
kdaikkkltgikhelqancyeevkdrctlaeklggsavislegkpl

SCOPe Domain Coordinates for d1q8ga_:

Click to download the PDB-style file with coordinates for d1q8ga_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ga_: