PDB entry 1q7x

View 1q7x on RCSB PDB site
Description: Solution structure of the alternatively spliced PDZ2 domain (PDZ2b) of PTP-Bas (hPTP1E)
Class: hydrolase
Keywords: Phosphatase, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE
Deposited on 2003-08-20, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PDZ2b domain of PTP-Bas (hPTP1E)
  Species: Homo sapiens [TaxId:9606]
  Gene: PTP1E
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12923 (0-107)
    • cloning artifact (0)
  Domains in SCOPe 2.07: d1q7xa1, d1q7xa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q7xA (A:)
  gssppkpgdifevelakndnslgisvtvlfdkggvntsvrhggiyvkavipqgaaesdgr
  ihkgdrvlavngvslegathkqavetlrntgqvvhlllekgqsptske