PDB entry 1q77
View 1q77 on RCSB PDB site
Description: X-ray crystal structure of putative Universal Stress Protein from Aquifex aeolicus
Class: Structural genomics, unknown function
Keywords: Structural genomics, universal stress protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on
2003-08-16, released
2003-11-18
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Hypothetical protein AQ_178
Species: Aquifex aeolicus [TaxId:63363]
Gene: aq_178
Database cross-references and differences (RAF-indexed):
- Uniprot O66565 (3-137)
- cloning artifact (0-2)
- modified residue (3)
Domains in SCOPe 2.04: d1q77a_ - Chain 'B':
Compound: Hypothetical protein AQ_178
Species: Aquifex aeolicus [TaxId:63363]
Gene: aq_178
Database cross-references and differences (RAF-indexed):
- Uniprot O66565 (3-137)
- cloning artifact (0-2)
- modified residue (3)
Domains in SCOPe 2.04: d1q77b_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1q77A (A:)
snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
aylckvidglnlaslivk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1q77B (B:)
snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
aylckvidglnlaslivk