PDB entry 1q77

View 1q77 on RCSB PDB site
Description: X-ray crystal structure of putative Universal Stress Protein from Aquifex aeolicus
Class: Structural genomics, unknown function
Keywords: Structural genomics, universal stress protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2003-08-16, released 2003-11-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein AQ_178
  Species: Aquifex aeolicus [TaxId:63363]
  Gene: aq_178
  Database cross-references and differences (RAF-indexed):
  • Uniprot O66565 (3-137)
    • cloning artifact (0-2)
    • modified residue (3)
  Domains in SCOPe 2.04: d1q77a_
• Chain 'B':
  Compound: Hypothetical protein AQ_178
  Species: Aquifex aeolicus [TaxId:63363]
  Gene: aq_178
  Database cross-references and differences (RAF-indexed):
  • Uniprot O66565 (3-137)
    • cloning artifact (0-2)
    • modified residue (3)
  Domains in SCOPe 2.04: d1q77b_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q77A (A:)
  snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
  eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
  aylckvidglnlaslivk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q77B (B:)
  snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
  eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
  aylckvidglnlaslivk