PDB entry 1q48

View 1q48 on RCSB PDB site
Description: Solution NMR Structure of The Haemophilus Influenzae Iron-Sulfur Cluster Assembly Protein U (IscU) with Zinc Bound at the Active Site. Northeast Structural Genomics Consortium Target IR24. This protein is not apo, it is a model without zinc binding constraints.
Class: structural genomics, unknown function
Keywords: Iron-Sulfur cluster binding, Three conserved Cys, 3 beta strands, 4 alpha helixes, NESG, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2003-08-01, released 2003-11-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NifU-like protein
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0377
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57074 (0-125)
      • insertion (126-133)
    Domains in SCOPe 2.02: d1q48a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q48A (A:)
    maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfkt
    ygcgsaiassslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiad
    ykakqglehhhhhh