PDB entry 1q2i

View 1q2i on RCSB PDB site
Description: nmr solution structure of a peptide from the mdm-2 binding domain of the p53 protein that is selectively cytotoxic to cancer cells
Class: antitumor protein
Keywords: p53 Protein, mdm-2 Binding Domain, Penetratin, Antitumor, NMR, ANTITUMOR PROTEIN
Deposited on 2003-07-24, released 2004-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pnc27
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1Q2I (0-31)
  Domains in SCOPe 2.08: d1q2ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q2iA (A:)
  pplsqetfsdlwkllkkwkmrrnqfwvkvqrg