Lineage for d1q2ia_ (1q2i A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046973Fold j.69: Tumor suppressor p53 fragments [58743] (1 superfamily)
  4. 3046974Superfamily j.69.1: Tumor suppressor p53 fragments [58744] (1 family) (S)
  5. 3046975Family j.69.1.1: Tumor suppressor p53 fragments [58745] (2 proteins)
  6. 3046980Protein N-terminal, MDM-2 binding domain [103753] (1 species)
    selectively cytotoxic to cancer cells
  7. 3046981Species Synthetic [103754] (2 PDB entries)
  8. 3046983Domain d1q2ia_: 1q2i A: [95628]

Details for d1q2ia_

PDB Entry: 1q2i (more details)

PDB Description: nmr solution structure of a peptide from the mdm-2 binding domain of the p53 protein that is selectively cytotoxic to cancer cells
PDB Compounds: (A:) pnc27

SCOPe Domain Sequences for d1q2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ia_ j.69.1.1 (A:) N-terminal, MDM-2 binding domain {Synthetic}
pplsqetfsdlwkllkkwkmrrnqfwvkvqrg

SCOPe Domain Coordinates for d1q2ia_:

Click to download the PDB-style file with coordinates for d1q2ia_.
(The format of our PDB-style files is described here.)

Timeline for d1q2ia_: